PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10818A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 182aa    MW: 20107.9 Da    PI: 9.6532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10818AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Oropetium_20150105_10818A 14 KGAWTKEEDQRLVAYIRAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                               79********************************************97 PP

2Myb_DNA-binding543.7e-1767111147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg++T eE + ++++++ lG++ W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_10818A  67 RGNFTDEEVDTIIKLHQILGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                                89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.504961IPR017930Myb domain
SMARTSM007177.2E-131363IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-2913108IPR009057Homeodomain-like
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001677.92E-111661No hitNo description
PROSITE profilePS5129426.71862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001675.67E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIR AHGEGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TDEEVDTIIK LHQILGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLIACG  120
IDPQTHRPLR VSAAAAATAR TSGQLETRTS CSPASSSDED SMPAQHLAGS IDLNLSLSLS  180
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM1569051e-138AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBankEU9639111e-138EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBankHQ8586921e-138HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977234.18e-98PREDICTED: myb-related protein Zm38-like
SwissprotQ9SZP16e-87MYB4_ARATH; Transcription repressor MYB4
TrEMBLK3YA569e-98K3YA56_SETIT; Uncharacterized protein
STRINGSi011098m3e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-85myb domain protein 4